CircNet

General Information

circRNA Basic Information

CircID	chr11:111964549\|111974983
Strand	+
CircType	exon
Host Gene	ENSG00000150764.13;
Algorism	CIRI2;
Sequence	GAACAGCAGCATGGATGAGGAAATTGAGAATCCATACTGGAGTGTGCGGGCCCTAGTGCAGCAGTACGAAGGGCAACAAAGGTCCCCGTCTGAATCCAGCTGCTCCAG

circRNA Expression in different cancers

circRNA-miRNA-gene regulatory network

Target miRNAs

CircID	miRNA	PITA	miRanda	targetScan

Target Genes

Note about Function Analysis:
We also provide this interface that can help researchers to perform GO, KEGG and disease enrichment analysis easily. This function will take around 30 seconds. After the analysis, this page will automatically jump to the result page.

Target miRNA Expression in different cancers

circRNA Open Reading Frame (ORF)

CircID	chr11:111964549\|111974983
ORF Type	ORF1
Protein Length	32
Nucleotide Length	96
Protein Sequence	MDEEIENPYWSVRALVQQYEGQQRSPSESSCS
Nucleotide Sequence	ATGGATGAGGAAATTGAGAATCCATACTGGAGTGTGCGGGCCCTAGTGCAGCAGTACGAAGGGCAACAAAGGTCCCCGTCTGAATCCAGCTGCTCC

RNA Binding Protein (RBP) of circRNA

CircID	RBP	Number of Upstream Sites	Number of Downstream Sites	Number of Circ Exons Sites
chr11:111964549\|111974983	U2AF2	8	11	0
chr11:111964549\|111974983	MOV10	0	1	0
chr11:111964549\|111974983	ELAVL1	0	6	0
chr11:111964549\|111974983	PRPF8	0	3	0
chr11:111964549\|111974983	UPF1	0	2	0
chr11:111964549\|111974983	FUS	1	0	0
chr11:111964549\|111974983	DGCR8	0	1	0
chr11:111964549\|111974983	SRSF7	0	0	1
chr11:111964549\|111974983	SRSF1	1	0	1
chr11:111964549\|111974983	KHSRP	0	4	0
chr11:111964549\|111974983	SRSF9	1	0	0
chr11:111964549\|111974983	HNRNPL	0	1	0
chr11:111964549\|111974983	HNRNPA2B1	0	1	0
chr11:111964549\|111974983	PTBP1	2	0	0
chr11:111964549\|111974983	HNRNPC	3	0	0
chr11:111964549\|111974983	HNRNPD	0	1	0
chr11:111964549\|111974983	DDX3X	0	1	0
chr11:111964549\|111974983	SND1	0	1	0
chr11:111964549\|111974983	IGF2BP2	0	3	0
chr11:111964549\|111974983	TARDBP	1	0	0
chr11:111964549\|111974983	BUD13	2	1	1
chr11:111964549\|111974983	CSTF2T	0	1	0
chr11:111964549\|111974983	EIF4A3	1	1	2
chr11:111964549\|111974983	AGO2	0	1	0

CircRNA Information