CircNet

General Information

circRNA Basic Information

CircID	chr22:50524005\|50524096
Strand	+
CircType	exon
Host Gene	ENSG00000130489.11;
Algorism	CIRI2;
Sequence	CTGCTGGATCACAGAGGCCGGGCTCGCTGCAAGGCTGACTTCCGGGGCCAGTGGGTGCTGATGTACTTTGGCTTCACTCACTGCCCTGACAT

circRNA Expression in different cancers

circRNA-miRNA-gene regulatory network

Target miRNAs

CircID	miRNA	PITA	miRanda	targetScan
chr22:50524005\|50524096	hsa-miR-34a-5p	0	0	1
chr22:50524005\|50524096	hsa-miR-34a-3p	0	0	1
chr22:50524005\|50524096	hsa-miR-449a	0	0	1
chr22:50524005\|50524096	hsa-miR-193b-5p	0	0	1
chr22:50524005\|50524096	hsa-miR-193b-3p	0	0	1
chr22:50524005\|50524096	hsa-miR-640	0	0	1
chr22:50524005\|50524096	hsa-miR-449b-5p	0	0	1
chr22:50524005\|50524096	hsa-miR-449b-3p	0	0	1
chr22:50524005\|50524096	hsa-miR-1301-5p	0	0	1
chr22:50524005\|50524096	hsa-miR-1301-3p	0	0	1
chr22:50524005\|50524096	hsa-miR-548k	0	0	1
chr22:50524005\|50524096	hsa-miR-338-3p	0	0	1
chr22:50524005\|50524096	hsa-miR-34c-5p	0	1	1
chr22:50524005\|50524096	hsa-miR-193a-3p	0	1	1
chr22:50524005\|50524096	hsa-miR-499-3p	0	0	1
chr22:50524005\|50524096	hsa-miR-1538	1	0	0
chr22:50524005\|50524096	hsa-miR-3973	0	1	0
chr22:50524005\|50524096	hsa-miR-6871-3p	0	1	0
chr22:50524005\|50524096	hsa-miR-3617-3p	0	1	0
chr22:50524005\|50524096	hsa-miR-6879-5p	0	1	0
chr22:50524005\|50524096	hsa-miR-4632-5p	0	1	0
chr22:50524005\|50524096	hsa-miR-4685-5p	0	1	0
chr22:50524005\|50524096	hsa-miR-4436b-3p	0	1	0
chr22:50524005\|50524096	hsa-miR-4757-5p	0	1	0
chr22:50524005\|50524096	hsa-miR-6744-3p	0	1	0
chr22:50524005\|50524096	hsa-miR-7157-5p	0	1	0

Target Genes

Note about Function Analysis:
We also provide this interface that can help researchers to perform GO, KEGG and disease enrichment analysis easily. This function will take around 30 seconds. After the analysis, this page will automatically jump to the result page.

Target miRNA Expression in different cancers

circRNA Open Reading Frame (ORF)

CircID	chr22:50524005\|50524096
ORF Type	ORF1
Protein Length	30
Nucleotide Length	90
Protein Sequence	LLDHRGRARCKADFRGQWVLMYFGFTHCPD
Nucleotide Sequence	CTGCTGGATCACAGAGGCCGGGCTCGCTGCAAGGCTGACTTCCGGGGCCAGTGGGTGCTGATGTACTTTGGCTTCACTCACTGCCCTGAC

RNA Binding Protein (RBP) of circRNA

CircID	RBP	Number of Upstream Sites	Number of Downstream Sites	Number of Circ Exons Sites

CircRNA Information